Protein Info for BWI76_RS06380 in Klebsiella michiganensis M5al

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 11 to 620 (610 residues), 1047.8 bits, E=0
• PF13292: DXP_synthase_N
  • amino acids 13 to 282 (270 residues), 389.6 bits, E=1.9e-120
• PF00676: E1_dh
  • amino acids 123 to 186 (64 residues), 23.8 bits, E=5.2e-09
• PF02775: TPP_enzyme_C
  • amino acids 126 to 183 (58 residues), 22.3 bits, 2.4e-08
• PF02779: Transket_pyr
  • amino acids 320 to 480 (161 residues), 161 bits, E=5.8e-51
• PF02780: Transketolase_C
  • amino acids 495 to 611 (117 residues), 90 bits, E=2.9e-29

Best Hits

Swiss-Prot: 95% identical to DXS_KLEP3: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 90% identity to eco:b0420)

MetaCyc: 90% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• isoprene biosynthesis I (9/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See A0A285AZJ7 at UniProt or InterPro

Protein Sequence (620 amino acids)

>BWI76_RS06380 1-deoxy-D-xylulose-5-phosphate synthase (Klebsiella michiganensis M5al)
MSFDIAKYPTLALVDSTQELRLLPKDSLPKLCDELRRYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRIGTIRQKGGLHPFPWRGESEYDVLSV
GHSSTSISAGIGIAIAAAKEDKQRRAVCVIGDGAITAGMAFEAMNHAGDIKPDLLVVLND
NEMSISENVGALNNHLAQLLSGKLYSTLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPG
TLFEELGFNYIGPVDGHDVIGLVNTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHA
VPKFDHTSGVLPKSSGGLPSYSKIFGDWLCETAAKDDKLMAVTPAMREGSGMVEFSKKYP
DQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDR
AGIVGADGQTHQGAFDISFLRCIPDMVIMTPSDENECRQMLYTGYHYNDGPCAVRYPRGS
GTGAPFEPLASLPIGKGVVKREGEKIAILNFGTLLPQAAKVAEKLNATLVDMRFAKPLDE
ALVLQLAAEHEVLVTLEENAIMGGAGSGVNELLMSRRRAVPVLNLGLPDFFIPQGTQEEA
HADLGLDAAGIEAKIHAWLA