Protein Info for BWI76_RS06360 in Klebsiella michiganensis M5al

Annotation: N utilization substance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR01951: transcription antitermination factor NusB" amino acids 6 to 131 (126 residues), 150.5 bits, see alignment E=1.5e-48 PF01029: NusB" amino acids 7 to 131 (125 residues), 123 bits, see alignment E=5.8e-40

Best Hits

Swiss-Prot: 99% identical to NUSB_CITK8: Transcription antitermination protein NusB (nusB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 96% identity to eco:b0416)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZG5 at UniProt or InterPro

Protein Sequence (139 amino acids)

>BWI76_RS06360 N utilization substance protein B (Klebsiella michiganensis M5al)
MKPAARRRARECAVQALYSWQLSKNDIADVEYQFLAEQDVKDVDVLYFRELLSGVATNSA
YLDGLMKPYLSRLLDELGQVEKAVLRIALFELSKRSDVPYKVAINEAIELAKTFGAEDSH
KFVNGVLDKAAPVIRPNKK