Protein Info for BWI76_RS06355 in Klebsiella michiganensis M5al

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 13 to 151 (139 residues), 191.6 bits, E=3e-61
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 14 to 150 (137 residues), 199.7 bits, E=9.8e-64

Best Hits

Swiss-Prot: 98% identical to RISB_SHIDS: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 98% identity to eco:b0415)

MetaCyc: 98% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See A0A285AZJ9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>BWI76_RS06355 6,7-dimethyl-8-ribityllumazine synthase (Klebsiella michiganensis M5al)
MNIIEANVATPDARVAITIARFNNFINDSLLDGAIDALKRIGQVKDENITVVWVPGAYEL
PLAADALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHVAQDSGIPVAFGVLTTE
SIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA