Protein Info for BWI76_RS06315 in Klebsiella michiganensis M5al

Annotation: protein translocase subunit SecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 271 to 271 (1 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details PF07549: Sec_GG" amino acids 39 to 66 (28 residues), 44.1 bits, see alignment (E = 9.9e-16) TIGR00966: protein-export membrane protein SecF" amino acids 45 to 292 (248 residues), 289.7 bits, see alignment E=2.1e-90 PF02355: SecD_SecF_C" amino acids 118 to 301 (184 residues), 231.7 bits, see alignment E=4.8e-73 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 125 to 289 (165 residues), 179.1 bits, see alignment E=1.1e-56

Best Hits

Swiss-Prot: 88% identical to SECF_ECOLI: Protein translocase subunit SecF (secF) from Escherichia coli (strain K12)

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 94% identity to enc:ECL_01166)

MetaCyc: 88% identical to Sec translocon accessory complex subunit SecF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZF5 at UniProt or InterPro

Protein Sequence (323 amino acids)

>BWI76_RS06315 protein translocase subunit SecF (Klebsiella michiganensis M5al)
MAQEYTVEQLNHGRKVWDFMRWDYWAFGISGFLLILSIIIIGVRGFNWGLDFTGGTVIEI
TLEKPVDMDQVRQSLQKAGFEEPQLQNFGSSRDIMVRMPPVHDANGSQELGSKVVSVINE
STSQNATVKRIEFVGPSVGADLAQTGALALIAALVCILIYVGFRFEWRLAAGVVIALAHD
VVITMGVLSLLHIEIDLTIVASLMSVIGYSLNDSIVVSDRIRENFRKIRRGTPYEIFNVS
LTQTLHRTLITSGTTLMVILMLYLFGGPILAGFSLTMLIGVSIGTASSIYVASALALKLG
MKREHMLQQKVEKEGADQPSILP