Protein Info for BWI76_RS06275 in Klebsiella michiganensis M5al

Annotation: beta-carotene 15,15'-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 883 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 432 to 449 (18 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details amino acids 511 to 533 (23 residues), see Phobius details amino acids 539 to 558 (20 residues), see Phobius details amino acids 569 to 586 (18 residues), see Phobius details amino acids 592 to 613 (22 residues), see Phobius details amino acids 625 to 645 (21 residues), see Phobius details amino acids 653 to 675 (23 residues), see Phobius details amino acids 688 to 709 (22 residues), see Phobius details amino acids 723 to 744 (22 residues), see Phobius details amino acids 762 to 783 (22 residues), see Phobius details amino acids 798 to 817 (20 residues), see Phobius details amino acids 828 to 845 (18 residues), see Phobius details amino acids 854 to 874 (21 residues), see Phobius details PF10101: DUF2339" amino acids 134 to 532 (399 residues), 373.8 bits, see alignment E=1.2e-115 amino acids 543 to 876 (334 residues), 190.8 bits, see alignment E=2.7e-60

Best Hits

KEGG orthology group: None (inferred from 72% identity to cko:CKO_02760)

Predicted SEED Role

"FIG00509783: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZQ8 at UniProt or InterPro

Protein Sequence (883 amino acids)

>BWI76_RS06275 beta-carotene 15,15'-monooxygenase (Klebsiella michiganensis M5al)
MDDLLIFGGVILFCGLVVAPIVAIVALRRSAAVRFELAALRRRVEELERRGAEQAPAAEA
TAVAPTTPAAAIAADAMMAEPSEPRPEPEAEAIDPWRAQPTPQPEPTVKSAPESEPPSAF
GGIISSLVAWFMQGNPLAKLGILLLFLGLSFLLRYTVEHALFPLELRLVAAALFAVVLLA
VGWRLRHKQPVYALILQGGATGALYLTVFGAFRLWQMLPMTLAFALLVAICAASVGLAIV
QKALSLAMLASLGGYLAPLLLSTGGGSHVALFSFYLLLSVGILAISIRQHWRELNLLGLL
FTFGIGGLWGLNEYRPAFYLSCQLFLIANTLIFGVLSVALSLRAQEKGRQIIDGVLLFAP
PLVGFGMQYAITRHMAYGPALSALGYGGFYLALAWLALRRYPSLGKPLVLAALALGGAFT
TLAIPLALSARWTAMAWSLEGLGILWLGVQQQQRRMSYSGTALLVLAVGSALWAQANGAT
PLSLLLIFAVLSLSWLTAAWLWRTVQVQGSWGLLIGGLLFWMVALVGASQLALSKDAQIV
FGVLAALAASVWCWRAAAARLAWQELDASKWLLWPMMLMVLFYQLSQQQIFAAGWQNLAW
CAALPAAAALLWRDGHSLPPRLNKLAHLSLLWMILLALAMELFWFTQDLPWGMSAWASGL
MMAAGGMLIFLVSEAVHRQVWPFRVWPALYASQAMIPVAVALGCLLMLTNVQDGTVYGQT
YFPLINPLEEGAAFALLGLTIFYRVSRRYFPLQLSVCRPWPIVALLALGFWWLNGLLLRA
LAWYGEVAWSITPLWHSRLIQTTFALVWTLVALTVMLRATRRLSRREWLCGAALLGIVIV
KLMLVDSAGGGGLARAVAFIGVAILVLIVGYFSPLPPKAGEKK