Protein Info for BWI76_RS06175 in Klebsiella michiganensis M5al

Annotation: DUF188 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02639: DUF188" amino acids 17 to 144 (128 residues), 169.1 bits, see alignment E=1.8e-54

Best Hits

Swiss-Prot: 92% identical to Y4355_KLEP3: UPF0178 protein KPK_4355 (KPK_4355) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_12385)

Predicted SEED Role

"Protein YaiI" in subsystem CBSS-562.2.peg.5158 SK3 including

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZN5 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BWI76_RS06175 DUF188 domain-containing protein (Klebsiella michiganensis M5al)
MAIWVDADACPNVIKDILFRAAERTQISLTLVANQPLRVPPSRFIRTLRVAQGFDVADNE
IVRLCEPGDLVITADIPLAAEVLEKGGAALNPRGERYSEATIRERLTMRDFMETMRASGV
QTGGPDSLSQRDRQQFAAALEKWLLEVKRPQA