Protein Info for BWI76_RS06145 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 377 (359 residues), 200.5 bits, see alignment E=3.8e-63 amino acids 264 to 418 (155 residues), 52.6 bits, see alignment E=3.6e-18

Best Hits

KEGG orthology group: None (inferred from 90% identity to cko:CKO_02792)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZF9 at UniProt or InterPro

Protein Sequence (428 amino acids)

>BWI76_RS06145 MFS transporter (Klebsiella michiganensis M5al)
MHMLAKLPARRWWYLMPIIFITYSLAYLDRANYGFAAAAGIESDLGITKGTASLIGALFF
LGYFFFQVPGAIYAVKRSVRKMIFCSLILWGFCAAATGFVSNIPMLMAIRFTLGVVEAAV
MPAMLIYISNWFTKTERSRANTFLILGNPVTVLWMSIVSGYLIQAWGWREMFIIEGIPAV
LWAVCWWILVRDKPSEVSWLNEQEKETLQKVMDSEQSHIKPVRNYGEALRSRNVIMLCAV
HALWSIGVYGFMMWMPSILKNAAQMDIVAVGWLAAVPYLAAIILMLTVSWLSDKFQNRKL
FIWPLLLIAAIAFFGSWMVGNQAFWLSYALLVIAAACMYAPYGPFFALIPELLPRNVSGV
SMGLINSFGALGAFLGAWLVGYLNGITGGPGVSYTFMAVALLSSVVLMFNVRANPQSSSP
AVAKRVVG