Protein Info for BWI76_RS06140 in Klebsiella michiganensis M5al

Annotation: gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00106: adh_short" amino acids 10 to 203 (194 residues), 220.2 bits, see alignment E=2.8e-69 PF08659: KR" amino acids 13 to 163 (151 residues), 54.4 bits, see alignment E=2.3e-18 PF13561: adh_short_C2" amino acids 16 to 250 (235 residues), 206.9 bits, see alignment E=5.4e-65

Best Hits

Swiss-Prot: 70% identical to IDNO_ECOL6: 5-keto-D-gluconate 5-reductase (idnO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 84% identity to cko:CKO_02793)

MetaCyc: 70% identical to 5-keto-D-gluconate 5-reductase (Escherichia coli K-12 substr. MG1655)
Gluconate 5-dehydrogenase. [EC: 1.1.1.69]; RXN0-7101 [EC: 1.1.1.69]

Predicted SEED Role

"5-keto-D-gluconate 5-reductase (EC 1.1.1.69)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.69)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZI9 at UniProt or InterPro

Protein Sequence (254 amino acids)

>BWI76_RS06140 gluconate 5-dehydrogenase (Klebsiella michiganensis M5al)
MRNLFDLSGKRALITGSAQGIGHLLAGGLAEYGAEIIINDRTQERADQAAQALVAQGFRA
VGYAFDVTQAAQVEQTIARIEEEVGAIDILINNAGIQRRFPFTEFPEEEWDNVIEVNQKG
VFLVSQQVAKYMMGRRAGKIINICSMQSELGRKTITPYAASKGAVKMLTRGMCVELAEYN
IQVNGIAPGYFATEMTTALVNDEAFSAWLYQRTPAARWGKPEELIGAAVYLASSAANFVN
GHLLFVDGGMLAAV