Protein Info for BWI76_RS06135 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 206 to 236 (31 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 238 (228 residues), 109.7 bits, see alignment E=2.3e-35 amino acids 217 to 394 (178 residues), 82.4 bits, see alignment E=4.7e-27 PF12832: MFS_1_like" amino acids 16 to 374 (359 residues), 44.5 bits, see alignment E=1.8e-15 PF00083: Sugar_tr" amino acids 39 to 206 (168 residues), 41.4 bits, see alignment E=1.4e-14 amino acids 251 to 384 (134 residues), 24 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 59% identical to MDTG_KLEP3: Multidrug resistance protein MdtG (mdtG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_12360)

MetaCyc: 60% identical to efflux pump MdtG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-342; TRANS-RXN0-589

Predicted SEED Role

"Multidrug-efflux transporter, major facilitator superfamily (MFS) (TC 2.A.1)" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZE8 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BWI76_RS06135 MFS transporter (Klebsiella michiganensis M5al)
MESWKVNLISVWFGCFFTGLAISQILPFLPLYVSQLGVTSHEALSMWSGLTFSVTFLVSA
IVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATNVWQLFILRAVMGLTSGYIPNAM
ALVASQVPRERSGWALSTLSTAQISGVIGGPLLGGFLADHVGLRAVFIITAILLTVSFLV
TLFLIKEGARPQVSKAERLSGKAVFASLPYPGLVISLFFTTLVIQLCNGSIGPILALFIK
SMAPDSNNIAFLAGMIAAVPGVSALISAPRLGKLGDRIGTSRILLATLCCAVVMFFAMSF
VTTPFQLGVLRFLLGFADGAMLPAVQTLLLKYCSDSVTGRIFGYNQSFMYLGNVAGPLIG
ASVSAMAGFRWVFIATAIIVLINIWQLAIMLRRSRRTAA