Protein Info for BWI76_RS06105 in Klebsiella michiganensis M5al

Annotation: microcin B17 transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 85 to 112 (28 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details PF05992: SbmA_BacA" amino acids 80 to 393 (314 residues), 548.3 bits, see alignment E=6.8e-169 PF06472: ABC_membrane_2" amino acids 98 to 283 (186 residues), 40.2 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 87% identical to SBMA_ECO57: Peptide antibiotic transporter SbmA (sbmA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to kva:Kvar_4062)

MetaCyc: 87% identical to peptide antibiotic/peptide nucleic acid transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-205A

Predicted SEED Role

"SbmA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZA1 at UniProt or InterPro

Protein Sequence (406 amino acids)

>BWI76_RS06105 microcin B17 transporter (Klebsiella michiganensis M5al)
MFKSFFPKPGPFFISAFIWSLLAVIFWQAGGGDWLLRATGASQDVAISAARFWSLNYLVF
YAFYVFCVGVFALFWFIYSPHRWQYWSILGTSLIIFVTWFLVEVGVAINAWYAPFYDLIQ
AALATPHKVSINQFYHEIGIFLGIALIAVIIGVMNNFFVSHYVFRWRTAMNEHYMAHWQH
LRHIEGAAQRVQEDTMRFASTLESMGVSFLNAVMTLIAFLPVLVTLSAHVPDLPIVGHLP
YGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRKELVYGEDDASRATPPTVRE
LFGAVRRNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFPSIVAGTITLGLMTQITNVFG
QVRGSFQYLISSWTTLVELMSIYKRLRSFERELDGKELLEVTQTLS