Protein Info for BWI76_RS06090 in Klebsiella michiganensis M5al

Annotation: delta-aminolevulinic acid dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF00490: ALAD" amino acids 6 to 319 (314 residues), 445.8 bits, see alignment E=4.3e-138

Best Hits

Swiss-Prot: 92% identical to HEM2_SHIFL: Delta-aminolevulinic acid dehydratase (hemB) from Shigella flexneri

KEGG orthology group: K01698, porphobilinogen synthase [EC: 4.2.1.24] (inferred from 95% identity to kpn:KPN_00316)

MetaCyc: 92% identical to porphobilinogen synthase (Escherichia coli K-12 substr. MG1655)
Porphobilinogen synthase. [EC: 4.2.1.24]

Predicted SEED Role

"Porphobilinogen synthase (EC 4.2.1.24)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZI0 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BWI76_RS06090 delta-aminolevulinic acid dehydratase (Klebsiella michiganensis M5al)
MTDLITRPRRLRKSASLRAMFEETTLSLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPERH
LAREIERIANAGIRSVMTFGISHHTDAVGSDTWNENGLVARMSRICKEAVPEMIVMSDTC
FCEYTSHGHCGVLCDHGVDNDLTLANLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAQG
ADCLMVKPAGPYLDILRDLRERTNLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR