Protein Info for BWI76_RS06070 in Klebsiella michiganensis M5al

Annotation: taurine transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00005: ABC_tran" amino acids 17 to 156 (140 residues), 120.8 bits, see alignment E=3.4e-39

Best Hits

Swiss-Prot: 88% identical to TAUB_ECO57: Taurine import ATP-binding protein TauB (tauB) from Escherichia coli O157:H7

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 94% identity to kva:Kvar_4070)

MetaCyc: 88% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine transport ATP-binding protein TauB" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZA6 at UniProt or InterPro

Protein Sequence (255 amino acids)

>BWI76_RS06070 taurine transporter ATP-binding subunit (Klebsiella michiganensis M5al)
MLQISHLSADYGGKPALADINLTLDSGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSITL
EGQRVEGPGADRGVVFQHEGLLPWRNVQDNVALGLQLAGVDKTQRRATAARMLKKVGLEG
AEKRFIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTREQMQTLLLSLWHETGK
KVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLDFGRRFVAGESCRSIKSDPRFIEQR
EYVLSRVFEQREAFS