Protein Info for BWI76_RS06055 in Klebsiella michiganensis M5al

Annotation: MASE1 sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 234 to 250 (17 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details PF05231: MASE1" amino acids 11 to 281 (271 residues), 181.9 bits, see alignment E=2.6e-57 PF07730: HisKA_3" amino acids 316 to 380 (65 residues), 56.1 bits, see alignment E=6.7e-19 PF02518: HATPase_c" amino acids 423 to 506 (84 residues), 46.8 bits, see alignment E=5.6e-16

Best Hits

KEGG orthology group: K07675, two-component system, NarL family, sensor histidine kinase UhpB [EC: 2.7.13.3] (inferred from 90% identity to cko:CKO_02817)

Predicted SEED Role

"Sensor histidine protein kinase UhpB, glucose-6-phosphate specific (EC 2.7.13.3)" in subsystem Hexose Phosphate Uptake System (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZH2 at UniProt or InterPro

Protein Sequence (513 amino acids)

>BWI76_RS06055 MASE1 sensor histidine kinase (Klebsiella michiganensis M5al)
MSRSLRHGVISLFIVLAWGSGWLMLWTLGFYLTHNGQQAALFLPHGVYLALLILLSRRYW
PALALPPMLMLLWLHGEQLLNGYLLLAAPLIGLLPAGIAQQFWHRFPLYWQRLTLLLATV
TASALLNTALLSPFVKSPAMMLGLASFTGGVLLTPFVYLIFEFLRQQHRYHLLGLDTNNP
PLRTSLIIWCSLFFIIGIGTQMVLSPEIERLLLIVVFLPNVVMAWKFGWQGGVLSGLLGS
MMITIARQVGVGFSNLVELEIFLATQALLGIGLGIAISRQQHLAQNLHHYRQRLEAELAA
RRALAEKLIHTEEDTRKSLARELHDEIGQNITAIQIQSQLVKRARDPAQTQAAASQINDL
ARRIHHSTRQLLRQLRPPALDELSFKEALHHLLNEFAFAERGIRCRFDYRLTATPESETV
RFTLYRLLQELLNNVCKHADASEVAIALFQQGALLRLEVKDNGIGLRADQMAGFGIQGMR
ERVSALGGELTLESQRGTRVIVNLPTNLQQTAG