Protein Info for BWI76_RS06045 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13531: SBP_bac_11" amino acids 30 to 289 (260 residues), 63.5 bits, see alignment E=5.2e-21 PF01547: SBP_bac_1" amino acids 45 to 283 (239 residues), 52.8 bits, see alignment E=1.2e-17 PF13416: SBP_bac_8" amino acids 45 to 300 (256 residues), 76 bits, see alignment E=8.8e-25 PF13343: SBP_bac_6" amino acids 91 to 290 (200 residues), 102.1 bits, see alignment E=7.4e-33

Best Hits

Swiss-Prot: 72% identical to Y131_HAEIN: Uncharacterized protein HI_0131 (HI_0131) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 96% identity to cko:CKO_02819)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZH0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>BWI76_RS06045 hypothetical protein (Klebsiella michiganensis M5al)
MKKTLVTTLIASGIALATLSGAAHAKGRLVVYCSATNEMCEAETKAFGEKYDVKTSFIRN
GSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMGLLQPYKSPNLTQVMEQFRDPAKLK
GNYSSAVYVGILGFGVNTQRLKEKNLPVPKCWKDLTKPEYKGEIQIADPQSSGTAYTALA
TFAQLWGDDQAFDYLKQLNANVSQYTKSGIAPARNAARGETAIGIGFLHDYSLEKEQGAP
LELISPCEGTGYEIGGVSILKGARNLDNAKLFVDWVLSKEAQELAWKKGKSYQILTNTTA
ETSPNSLKLDDLKLINYDMDKYGSTDVRKALINKWVSEVKMGK