Protein Info for BWI76_RS06025 in Klebsiella michiganensis M5al

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 363 to 388 (26 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details PF00324: AA_permease" amino acids 19 to 462 (444 residues), 415.6 bits, see alignment E=2.5e-128 PF13520: AA_permease_2" amino acids 20 to 449 (430 residues), 147.1 bits, see alignment E=7.4e-47

Best Hits

Swiss-Prot: 94% identical to MMUP_ECOLI: Probable S-methylmethionine permease (mmuP) from Escherichia coli (strain K12)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 96% identity to kva:Kvar_4073)

MetaCyc: 94% identical to CP4-6 prophage; S-methyl-L-methionine transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-486

Predicted SEED Role

"S-methylmethionine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZF4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>BWI76_RS06025 amino acid transporter (Klebsiella michiganensis M5al)
MQTTQQQGGQLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAAGTLLAYLIGALVV
WLVMQCLGELSVAMPETGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQ
YWFPQVPVWVWCVVFCAVIFALNVISTRFFAEGEFWFSLVKVITIIAFIILGGAAIFGII
PMQDGSPAPGLRNITAEGWFPHGGLPILMTMVAVNFAFSGTELIGIAAGETENPHKVIPV
AIRTTIARLIIFFIGTVFVLAALIPMQQAGVEKSPFVLVFEKVGIPYAADIFNFVILTAI
LSAANSGLYASGRMLWSLSNENTLPACFTKLTRNGVPLTAISVSMLGGVLALFSSVVAPD
TVFVALSAISGFAVVAVWLSICASHFMFRRRHLQQGKALSELHYRAPWYPLVPALGFVLC
LVACVGLAFDPSQRIALWCGIPFVALCYGAYYLTRSRKLTQEPQHVAE