Protein Info for BWI76_RS05990 in Klebsiella michiganensis M5al

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 37 to 37 (1 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 281 (272 residues), 149.3 bits, see alignment E=6.4e-48

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to kpn:KPN_00304)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZB9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BWI76_RS05990 branched-chain amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MDGAIFLQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVGAFTTLFLFSSIG
LPFGVAVFLTLALCGLFGMLIDRVAYRPLRQASKISMLITAIGVSFFLENLFNVLFGGSS
RFFSAPDFFNNTRAFGDVIITNVAWIVPLITVLLLLAILWLLYRTRYGMAIRAVAFDVNT
VRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLKAFAAAVLGGIGS
VTGAVLGGFILGFTEVVAVALFPELGGYKDAFAFMFLILVLLFRPVGIMGDERLERSRF