Protein Info for BWI76_RS05905 in Klebsiella michiganensis M5al

Annotation: phosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 1 to 273 (273 residues), 263.8 bits, see alignment E=1.5e-82 TIGR03431: phosphonate ABC transporter, periplasmic phosphonate binding protein" amino acids 12 to 308 (297 residues), 303 bits, see alignment E=2.3e-94 PF12974: Phosphonate-bd" amino acids 37 to 291 (255 residues), 164.4 bits, see alignment E=1.6e-52

Best Hits

KEGG orthology group: None (inferred from 94% identity to eae:EAE_12195)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZB1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>BWI76_RS05905 phosphonate ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MKKYITGAVRLSAAVAGIMMAWQAGAAEQPKELNLGILGGQNATQQIGDNQCVKQFLDKE
LNVDTKLRNSSDYSGVIQGLLGGKVDVVLSMSPSSYASVYINNPKAVDIVGIAVDDKDQS
RGYHSVVIVKADSPYKKLEDLKGKAFGFADPDSTSGFLIPNHAFKQQFGGTSDNKYNNFF
SSVTFSGGHEQDILGVLNGQFAGAVTWTSMVGDYNSGYSVGAFNRLIRMDHPDLMKQIRI
IWQSPLIPNGPILVSNALPADFKAKVVTAIKKLDTDDHACFIKAMGGTQHIGPGSVADFQ
QIIDMKRELVSAR