Protein Info for BWI76_RS05900 in Klebsiella michiganensis M5al

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 230 to 245 (16 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 20 to 285 (266 residues), 283.3 bits, see alignment E=8.7e-89 PF00528: BPD_transp_1" amino acids 114 to 284 (171 residues), 66 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: None (inferred from 91% identity to eae:EAE_12190)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZE1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BWI76_RS05900 phosphonate ABC transporter, permease protein PhnE (Klebsiella michiganensis M5al)
MNNTHTEFERYYQQVRSRQKRDTLSGSLLLLALYFAAGSMAEFNLFTIWHSLPNFFDYMF
ETLPTLRVADLFADSHTKGSLAYWGYRLPIQLPLIWETLQLALASTLVAVAIATLLGFVA
ASNAWSPAPLRVAVRVLVAFLRTMPELAWAVIFVMAFGIGAIPGFLALMLHTIGSLTKLF
YEAVESAQDKPVRGLAACGASHLQRIRFALWPQVKPIFLSYGFMRLEINFRSSTILGLVG
AGGIGQELMTNIKLDRYDQVSITLLLIIIVVSLLDMLSGRLRQWVLEGKK