Protein Info for BWI76_RS05895 in Klebsiella michiganensis M5al

Annotation: phosphonate ABC transporter, permease protein PhnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 84 to 111 (28 residues), see Phobius details amino acids 120 to 134 (15 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 204 to 220 (17 residues), see Phobius details amino acids 228 to 245 (18 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 30 to 281 (252 residues), 257.2 bits, see alignment E=7.8e-81

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_12185)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ98 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BWI76_RS05895 phosphonate ABC transporter, permease protein PhnE (Klebsiella michiganensis M5al)
MNQWQKQPDIAASRRQHRHLYQAQGRYLRYVGLLALASVLYYVWFFMQFGISGGQLAAGL
QQISRYLLRMFVWHDFFNWPFRYYFTQIAITLAIVFAGTLTATVIALLLSFLAARNIMRG
VVPGLIALLMRRLFDVLRGIDMAIWGLIFVRAVGLGPLAGVLAIIMQDTGLLGRLYAEGH
EAVDRSPGRGLTAVGANGLQKHRFSIFTQSFPTFLALSLYQIESNTRSAAVLGFVGAGGI
GLIYAENMRLWNWDVVMFITLLLVAVVMAMDTLSAWLRRRYIGGSAVPLFKAG