Protein Info for BWI76_RS05870 in Klebsiella michiganensis M5al

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 22 to 161 (140 residues), 127.2 bits, E=3.7e-41

Best Hits

Swiss-Prot: 50% identical to Y4187_BRUSU: Putative ATP-binding protein BRA1187/BS1330_II1178 (BRA1187) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 95% identity to kva:Kvar_2991)

MetaCyc: 44% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

See A0A285AZ89 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BWI76_RS05870 ABC transporter (Klebsiella michiganensis M5al)
MTSSTLVSFRHVRKSWQQVTALQNFSLDIAAGELVALVGSSGCGKSTLLRMLVGLESATQ
GEIRINGEPVTGVGKERGIVFQEPRLFPWLNVLDNVMLGLADEKLSRAAKRQRALEMLER
VQLSEFANALPAQLSGGMAQRVAIARGLVARPQILMLDEPFGALDALTRHTLQQELLQIH
QRAGTTTLLVTHDVEEAVALADRVVVLSPRPGRIREVVSLALPHPRQRDDASFSAACRQI
RNLITTA