Protein Info for BWI76_RS05860 in Klebsiella michiganensis M5al

Annotation: alkanesulfonates-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF09084: NMT1" amino acids 63 to 247 (185 residues), 50.9 bits, see alignment E=2e-17 PF12974: Phosphonate-bd" amino acids 80 to 169 (90 residues), 33 bits, see alignment E=4.1e-12

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 94% identity to kva:Kvar_2993)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZD0 at UniProt or InterPro

Protein Sequence (355 amino acids)

>BWI76_RS05860 alkanesulfonates-binding protein (Klebsiella michiganensis M5al)
MMKAFFSRTLLALVAVIGLAASAQAEALRTIRIGVPDQSAGSKPFIEGPVGMAFIRHQLE
EVFKPQGVEVQWQFFKGAGPAVNEALANRQLDFVYLGDLAAIIGKANGLPTRLLLGSRGS
ESYLAVTKASGIKTLTDLQGKRVAVYRGTADQLAFDRALQSAGLNERSLQVINLDWNAGK
AALAAGRVDAVWGGVSLLALRGDKIDVVVKSGDSGRQNTTQAGFLGTQTFIDAWPQATQQ
IINVLVKNAAEINDPANRDAWSAEMAQQSQIPQALFLEELQPQDLNFTTSPRIDPFLTDS
FSSSVDQAKSGRLIRSAFDVSQWVDGQFVEQALKSLRLENRWPQYDAKGLAKDAG