Protein Info for BWI76_RS05770 in Klebsiella michiganensis M5al

Annotation: nucleoside triphosphatase, D5 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 777 PF08273: Zn_Ribbon_Prim" amino acids 30 to 66 (37 residues), 69.2 bits, see alignment 9.1e-23 PF01751: Toprim" amino acids 210 to 273 (64 residues), 27.3 bits, see alignment E=9.7e-10 PF13362: Toprim_3" amino acids 210 to 301 (92 residues), 44.3 bits, see alignment E=6.3e-15 PF08706: D5_N" amino acids 379 to 467 (89 residues), 33.7 bits, see alignment E=1.3e-11 PF19263: DUF5906" amino acids 500 to 608 (109 residues), 37.2 bits, see alignment E=1.2e-12 PF03288: Pox_D5" amino acids 670 to 769 (100 residues), 60.5 bits, see alignment E=5.5e-20

Best Hits

Swiss-Prot: 84% identical to PRIM_BPP4: Putative P4-specific DNA primase (Alpha) from Enterobacteria phage P4

KEGG orthology group: K06919, putative DNA primase/helicase (inferred from 91% identity to spq:SPAB_03426)

Predicted SEED Role

"Zinc binding domain / DNA primase (EC 2.7.7.-), Phage P4-associated / Replicative helicase RepA, Phage P4-associated" (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (777 amino acids)

>BWI76_RS05770 nucleoside triphosphatase, D5 family protein (Klebsiella michiganensis M5al)
MKMNVTDTVKQACGHWPRILPALGMKVIKNRHQACPVCGGADRFRFDDKEGRGTWFCNQC
GAGDGLKLVEKVFGVSASEAAGKVNAVTGHLPPVAPKVTAAAEAETEADRKAAAALAVRL
LEKTRPATGNAYLTRKGFAGRECLTLTASHKTGGVAYRAGDVVVPLYDESGTLVNLQLIN
AEGLKRTLKGGAVKGASHTIEGKKQAGKRLWIAEGYATALTVHHLTGETVMVALSSVNLL
SLASLARSKHPACQIILAADRDLNGTGQTKAAAAAQGCEGIVALPPVFGDWNDAVMLKGE
DATRKAIYAAIRPRAQSPFDTMSEAEFTAMSASDKAMRVHEHYGEALAVDANGQLLSRYE
NGIWKVIPPSDFARDVAGLFQRLRAPFSSGRIASVVETLKLIIPQQEAPARRLIGFRNGV
LDTQSGLFSPHSKSHWLRTLCDVDFTPPVEGETLETHAPNFWRWLDRAASGNPTKRNVIL
AALFMVLANRYDWQLFLEVTGPGGSGKSILAEIATMLAGEDNATSADIDTLEDPRKRASL
IGFSLIRLPDQEKWSGDGAGLKAITGGDAVSVDPKYQNPYSTHIPAVILAVNNNPMRFTD
RSGGVSRRRVIIHFPEQIAPEERDPQLRDKIARELAVIVRQLMQQFSDPMSARALLQSQQ
NSDEALSIKRDADPTFDFCGYLEMLPQTNGMFIGNASIIPRNYRKYLYHAYLAYMEANGY
RNVLSLKMFGLGLPMMLKEYGMNYEKRHTKQGIQTNLSLKEESYGDWLPKCDEPTAT