Protein Info for BWI76_RS05750 in Klebsiella michiganensis M5al

Annotation: thiamine biosynthesis protein ThiJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 9 to 168 (160 residues), 105 bits, E=1.9e-34

Best Hits

Swiss-Prot: 57% identical to INHA_PSEPU: Isonitrile hydratase (inhA) from Pseudomonas putida

KEGG orthology group: None (inferred from 85% identity to pam:PANA_1582)

MetaCyc: 57% identical to isocyanide hydratase subunit (Pseudomonas putida N19-2)
Cyclohexyl-isocyanide hydratase. [EC: 4.2.1.103]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Caprolactam degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.103

Sequence Analysis Tools

See A0A285AZ35 at UniProt or InterPro

Protein Sequence (231 amino acids)

>BWI76_RS05750 thiamine biosynthesis protein ThiJ (Klebsiella michiganensis M5al)
MSHSTDISIGLLLFPALTQLDLTGPYEVFTRAPDTKVHLIWKNLDLVVSDRGMAIQPTTT
FNACPALDVICVPGGPGQINLMEDEEVLSFIRAQSKQAKLITSVCTGALVLGAAGLLDGY
KATTHWASLGQLELLGAEPVNERVVRDRNRITGAGVTSGIDFALNVVSEIFGSDIAQNIQ
LHMEYDPAPPFNCGSPRSASEERLKKAQQQVAPFIEKRLQATLKAAAKLHK