Protein Info for BWI76_RS05695 in Klebsiella michiganensis M5al

Annotation: anaerobic C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 130 to 157 (28 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 427 (423 residues), 440.8 bits, see alignment E=3e-136 PF03605: DcuA_DcuB" amino acids 5 to 361 (357 residues), 344.5 bits, see alignment E=3.7e-107

Best Hits

KEGG orthology group: None (inferred from 94% identity to cro:ROD_03541)

Predicted SEED Role

"C4-dicarboxylate transporter DcuA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ23 at UniProt or InterPro

Protein Sequence (429 amino acids)

>BWI76_RS05695 anaerobic C4-dicarboxylate transporter (Klebsiella michiganensis M5al)
MILVQFLVVLLFLYIGMRVGGIGVGFAGGAGVIVLSALGATPGDMPMLVIVFIMVVIVAI
AAMQEAGGIEYLVDLTERLLRRYPRLLVITAPLSTWLLTMMASTGQVSFACMPVIVGVAK
ENNIKPTRALALSVSASLLGIVASPISAAVIFFSGILEKGHNGWGYIELIAVSIPSTFLA
LLVTSFFYLFWDRIRQQDRLCDNPVQVKARTERAIPPYAGRSVLIFIVGLVAVLAYAIVT
SPKLGLIAHPVMSSGQARVGVMMGVALLIVVCCRVNVHKVPSGSVFKTGMTSCICILGVA
WLGSTFMDSNQQWLQSTVSSHLLDSPIMLALIIMAASCFLYSQAASTKILFPAALSMGVA
PAILVACFPATASLFILPNYPTLLAAVELDDTGSTKLGRHIIDHPFLLPGLASVLLSILF
AAGLAFLIR