Protein Info for BWI76_RS05675 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details PF07690: MFS_1" amino acids 44 to 386 (343 residues), 136.4 bits, see alignment E=1.7e-43 amino acids 314 to 456 (143 residues), 47.3 bits, see alignment E=2.1e-16 PF06779: MFS_4" amino acids 59 to 222 (164 residues), 40.2 bits, see alignment E=4.4e-14 PF00083: Sugar_tr" amino acids 73 to 463 (391 residues), 167.6 bits, see alignment E=7e-53

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 97% identity to cro:ROD_03501)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ54 at UniProt or InterPro

Protein Sequence (465 amino acids)

>BWI76_RS05675 MFS transporter (Klebsiella michiganensis M5al)
MSTQAIASDYAVASGTASTPDALLARLERLPITRRLKAIRVIVGLSTFFDAYTIIAIAFA
LPQLTQEWGLTPTFVGLIIAASYVGQLCGALFFGSLAEKIGRIGVLRITIIMFVLMDAAC
LFAWNGWSILIIRFLQGVGIGAEVPVASAYINEFVGAKKRGRFFLLYEVIFPIGMMFAGL
VGYFLVPIYGWKVMFLIGLVPSALTVPLRWLMPESPRWLAAKGRLKEADNVVSTLESEVI
RRGMTLPEPEIKAPAVQKAAPEGVKALFGGIYKSRTFMLWGLWLTVYSVNNGMITWFPTL
YKTWFNLSLDTSLAYGWITSSCGVVASVICALLIDRVGRKRWYTWAFLLAVVPLIALSVL
GAKSAVEILILGSMTYAILQTIAFSLYLYAAELYPTRLRAIGTAYSSAWLRAGSSIGPLM
VGFIVSGFGIRFVFVTFAVIALIGGLITWIFAIETKGKSLEELSP