Protein Info for BWI76_RS05665 in Klebsiella michiganensis M5al

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13489: Methyltransf_23
  • amino acids 45 to 178 (134 residues), 49.5 bits, E=2.1e-16
• PF07021: MetW
  • amino acids 57 to 136 (80 residues), 21.5 bits, E=8e-08
• PF05175: MTS
  • amino acids 66 to 167 (102 residues), 30.8 bits, E=1.1e-10
• PF03848: TehB
  • amino acids 66 to 137 (72 residues), 22.6 bits, E=3.2e-08
• PF13847: Methyltransf_31
  • amino acids 66 to 134 (69 residues), 38.4 bits, E=5.2e-13
  • amino acids 329 to 437 (109 residues), 37.4 bits, E=1.1e-12
• PF13649: Methyltransf_25
  • amino acids 69 to 163 (95 residues), 68.9 bits, E=2.6e-22
  • amino acids 335 to 428 (94 residues), 37.9 bits, E=1.2e-12
• PF08242: Methyltransf_12
  • amino acids 70 to 165 (96 residues), 35.2 bits, E=8.6e-12
• PF08241: Methyltransf_11
  • amino acids 70 to 167 (98 residues), 50.2 bits, E=1.7e-16
  • amino acids 335 to 432 (98 residues), 33 bits, E=3.9e-11
• PF01135: PCMT
  • amino acids 316 to 432 (117 residues), 21.6 bits, E=8.1e-08
• PF02353: CMAS
  • amino acids 318 to 389 (72 residues), 28.3 bits, E=5.5e-10

Best Hits

KEGG orthology group: None (inferred from 75% identity to see:SNSL254_A4852)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

See A0A285AZ40 at UniProt or InterPro

Protein Sequence (542 amino acids)

>BWI76_RS05665 SAM-dependent methyltransferase (Klebsiella michiganensis M5al)
MTIGTIITGSRHIVLSSRERKIPWDDPAFSQRMLENHLSQEHDWASRRRAVIEQQVAWIA
GQLPAGARILDLGCGPGLYTRLLAERGFCCTGVDFSPASIAWARQQAQAAGLDIAYHQQD
VRDYAPETPFDFIMMTFGELNVFSAAEARSLVNRCAQWLVPWGKLLIEVHTYAEVKRQGM
AEPGWQRCPQGLFLDVPHLLLTEHAWDPAAQTSSTLFMAIEESGKVTRFGSQMTAWRDDA
YLDLLRTAGLTTITRPDEAEWPVSETFAGKLYALLAEKNVPDSLCATPIKGIQPLDIPRI
FTISESAHRIHNPFTPEKYAALGRVLRMKAGTRLLDLGSGSGEMLCTWARDHGIRGIGVD
MSALFSQQAQRRAEELGVADSVTFIHQDAAGYVAEEKCDIAACIGATWIGGGVAGTIALL
SKSLKPGGMLLIGEPYWRKIPATEEIAQACGASSLADFLTLPDLVSSYDALGYDLVEMVL
ADQEGWDRYEAAKWLTLRRWLEENPDDDFASEVRAELTMAPKRHVTWTREYFGWGVFALI
KR