Protein Info for BWI76_RS05660 in Klebsiella michiganensis M5al

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF13527: Acetyltransf_9" amino acids 11 to 132 (122 residues), 28.1 bits, see alignment E=2.8e-10 PF00583: Acetyltransf_1" amino acids 18 to 118 (101 residues), 37 bits, see alignment E=5.6e-13 PF13508: Acetyltransf_7" amino acids 51 to 132 (82 residues), 33.4 bits, see alignment E=7.3e-12

Best Hits

Swiss-Prot: 77% identical to YJHQ_ECOLI: Uncharacterized N-acetyltransferase YjhQ (yjhQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 79% identity to ecy:ECSE_0269)

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ19 at UniProt or InterPro

Protein Sequence (183 amino acids)

>BWI76_RS05660 N-acetyltransferase (Klebsiella michiganensis M5al)
MTNHSFTFHVASEGDTNDILHVETRAFGYSKEARLVADLLNDESACPTLSLLARHNGKAV
GHILFTRATFKGEPDSPMMHILAPLAVVPEYQGAGVGGGLIRHGIEQLKAMGSQTVFVLG
HATYYPRHGFEPCAGDKGYPAPYPIPEALKACWMLQPLSSQPLGRTGQIQCARALMKPEH
WRE