Protein Info for BWI76_RS05650 in Klebsiella michiganensis M5al

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF03786: UxuA" amino acids 1 to 388 (388 residues), 516.9 bits, see alignment E=2.2e-159 TIGR00695: mannonate dehydratase" amino acids 1 to 394 (394 residues), 768.2 bits, see alignment E=9.5e-236

Best Hits

Swiss-Prot: 95% identical to UXUA_ESCF3: Mannonate dehydratase (uxuA) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 94% identity to eco:b4322)

MetaCyc: 94% identical to D-mannonate dehydratase (Escherichia coli K-12 substr. MG1655)
Mannonate dehydratase. [EC: 4.2.1.8]

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.8

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ32 at UniProt or InterPro

Protein Sequence (394 amino acids)

>BWI76_RS05650 mannonate dehydratase (Klebsiella michiganensis M5al)
MEQTWRWYGPNDPVTLADVRQAGATGVVTALHHIPNGEVWTVDEILKRKAIVEEAGLVWS
VVESVPIHEEIKTHTGNYAQWIANYQQSLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLP
DGSKALRFDQIEFAAFELHILKRPGAEADYTAEEVAQANQRFAAMSDEDKARLTRNIIAG
LPGAEEGYTLDQFRQHLATYKDIDKAALRENFAVFMKAIIPVAEEAGVRMAVHPDDPPRP
ILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLR
STLREENPKTFHEAAHLHGDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDL
KKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR