Protein Info for BWI76_RS05600 in Klebsiella michiganensis M5al

Annotation: capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 419 to 440 (22 residues), see Phobius details PF02706: Wzz" amino acids 16 to 104 (89 residues), 27.8 bits, see alignment E=2.5e-10 PF13807: GNVR" amino acids 376 to 439 (64 residues), 28.1 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 82% identity to eae:EAE_12005)

Predicted SEED Role

"Capsular polysaccharide synthesis enzyme CpsD, exopolysaccharide synthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ22 at UniProt or InterPro

Protein Sequence (695 amino acids)

>BWI76_RS05600 capsular polysaccharide biosynthesis protein (Klebsiella michiganensis M5al)
MAISLVENGKKKEGFIDFTPYFNKIKHKLIWCLVVVVVAAAASWILTRFMSSSYTATATV
LFKAQPQDVTPLPRLENYDSTRSDYYETKYALMGSRVVLEAAVKAMKLEQDPEFNGGDNL
DLATRVNNAVRALQKNLTISGVRTTQLVSVSMEAKSPQKAADIANGVAQAFIDYSLAQKQ
KTLLQAQGWNEKMMDDLRAKLDRQKADIDDFLKQNGLLTFRSMDGYETERLGIVINHLAD
ATQRRLKAQTVWDKVRRQQGKPPEAIISLPEISGHPQIQDLRIALIQTRRNLSEAAKHYG
PKHPKYLQAQAQLQVVNGQIGQVLGELLNGLRQQYQIALDDEQHYQKMLDDQKADFQALG
AKRDKYNTMMTALNKTEELYKSLYQRANEQKLSETFSVPDEAIYDAAVPPNQPSKPQRGL
LIVMATLMALALYIMYLIVSTALDKTVNSISELKAKTGLDASGEFPLLPQANSAQLTFQN
LLYADMIHSLRLALLGQTESRGTILVTSAQTHAGSSLIAELLAWSASKSGKTLLIDLDYL
ANAGLSARYPQHKTGFSARLEDRCATPQAVVSLADNLDFMPRGELNDSTLLLLTSQRLPA
LLTTLRQTYDSLILNAPSLGLAQDGLLLAPHVDISLLVVKASEQASRVRDAQSRLHAAAP
TPVAIMLNQVKEENLETQEGKRLPERGMGELISPK