Protein Info for BWI76_RS05595 in Klebsiella michiganensis M5al

Annotation: capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_12000)

Predicted SEED Role

"O-antigen flippase Wzx" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYY1 at UniProt or InterPro

Protein Sequence (405 amino acids)

>BWI76_RS05595 capsular polysaccharide biosynthesis protein (Klebsiella michiganensis M5al)
MNLIKSISSIASSSVLSQAIGAFSVWLISHRYGMAEVGHYAMIYSNVLIGAQVCTFASQL
LIPRQEEHELGQNVVFCLLQSLLLALPWAVITGLIFHLNIAFLYLLTFGYALVLIAENLS
LRGGNYPFLTFQRIAVSLVVAIALLAMPNATLFYIAWMVGILLLLSLCLLRLFHFSTLTP
AHFSPRANGLFARQHWQHLSRVGSAEVLAMASNNLPTMLINVWFSPLVAGYFSVVSRFCL
SPVMIVGNAVRNSIFSKWSMDFRNNTFNYAEYKKIRLLLLAAALICILGIWIFYPLVMRL
GFSQEWLNSIPTSRYMLPYLFAALAVSPLTVIELIFGSKRYFLRIQIEQLLIIIAAFIAL
PELGQSYEIALLTFSVLTSIRYLFILLKMNKRALQLSRQEQKICS