Protein Info for BWI76_RS05580 in Klebsiella michiganensis M5al

Annotation: group 1 glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF13579: Glyco_trans_4_4" amino acids 14 to 216 (203 residues), 40.8 bits, see alignment E=7.3e-14 PF13439: Glyco_transf_4" amino acids 14 to 220 (207 residues), 60.9 bits, see alignment E=4.2e-20 PF00534: Glycos_transf_1" amino acids 230 to 378 (149 residues), 94.9 bits, see alignment E=1.1e-30 PF13692: Glyco_trans_1_4" amino acids 231 to 363 (133 residues), 95.8 bits, see alignment E=7.5e-31 PF13524: Glyco_trans_1_2" amino acids 281 to 392 (112 residues), 32 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to eae:EAE_11985)

Predicted SEED Role

"Putative glycosyltransferase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ57 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BWI76_RS05580 group 1 glycosyl transferase (Klebsiella michiganensis M5al)
MKILFVNKFFFIKGGAETVFFQERDAMLQAGYQVVDFSMQHAENKPSPWESFFVHNVDYH
QNHGLTGKLKAGIDFIYNAEACSKLNTLLLAQRPDIVHFHNIYHQLTPALIGVAKRFGCK
TVLTAHDYKIVCPSYTMLRDGHVCDDCLTGSVSNAFRHRCQQGDTFKSLLLSLEAYWQKF
AQNYAMLDCIIAPSEFMRQTLLRKLPRSRIETIVNGIDASATIPGDTAGDYFLYIGRLSR
EKGVATLALAQQKMQQPMPLKIVGDGPLGNDLRARFSGPEFLGYMRHGEALNALIRGARA
VIVPSEYYENCSMSVLEAMAFGRPVVGGNIGGIPEQIRDGIDGYLVEPGDADALARIMDG
LAANPQQAREMGINARQRLEEKYDLARHMQVLQELYQQLVGEAK