Protein Info for BWI76_RS05560 in Klebsiella michiganensis M5al

Annotation: serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details PF14602: Hexapep_2" amino acids 80 to 102 (23 residues), 12.3 bits, see alignment (E = 1.2e-05) amino acids 116 to 149 (34 residues), 34.5 bits, see alignment 1.4e-12 PF00132: Hexapep" amino acids 115 to 149 (35 residues), 35.9 bits, see alignment 4.1e-13

Best Hits

Swiss-Prot: 38% identical to WCAB_ECOLI: Putative colanic acid biosynthesis acetyltransferase WcaB (wcaB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 76% identity to eae:EAE_11965)

MetaCyc: 38% identical to colanic acid biosynthesis acetyltransferase WcaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ43 at UniProt or InterPro

Protein Sequence (168 amino acids)

>BWI76_RS05560 serine acetyltransferase (Klebsiella michiganensis M5al)
MFEAIRQVGQEIKSCGGIKAKIAVLLYRLATLYRSRNPLWKICGIPFVILNIVINECLFC
IELPWRARIGYGLKLYHPHCIVINRGTIIGQNCTLRQGVTIGSVTDSQGRESASPRIGDN
VEFGAHAVVIGAVTLGDNVKVGAGTVVTKDLAAGMIAVGQPYRVLNGD