Protein Info for BWI76_RS05555 in Klebsiella michiganensis M5al

Annotation: Crl family RNA polymerase assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF07417: Crl" amino acids 1 to 126 (126 residues), 193.4 bits, see alignment E=5.8e-62

Best Hits

Swiss-Prot: 78% identical to CRL_CITK8: Sigma factor-binding protein Crl (crl) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_11960)

Predicted SEED Role

"Curlin genes transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYY9 at UniProt or InterPro

Protein Sequence (132 amino acids)

>BWI76_RS05555 Crl family RNA polymerase assembly factor (Klebsiella michiganensis M5al)
MTLPSGHLKSKLIKKFTALGPYIREEQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMEM
EAQASRFTYSYQFGLFDKEGDWRPVAIDDPEVTEKLEKTLRDFHQRAEALLATFSLKLEP
ADDFSEPVKLRA