Protein Info for BWI76_RS05550 in Klebsiella michiganensis M5al

Annotation: fermentation/respiration switch protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF06500: FrsA-like" amino acids 1 to 412 (412 residues), 729.7 bits, see alignment E=4.3e-224

Best Hits

Swiss-Prot: 91% identical to Y4481_KLEP3: UPF0255 protein KPK_4481 (KPK_4481) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K11750, esterase FrsA [EC: 3.1.-.-] (inferred from 91% identity to kpn:KPN_00251)

Predicted SEED Role

"FIG00731723: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ14 at UniProt or InterPro

Protein Sequence (414 amino acids)

>BWI76_RS05550 fermentation/respiration switch protein (Klebsiella michiganensis M5al)
MSQANLSETLFKPRFKHPETSTLVRRFNTGAQQPIQSALSGNHVDHWYRLINRLMWIWRG
VTPQEILDVQARIVMSDAERTDPELYDTVVGYRGGNWIFEWAKQAMDWQQKAGQEENLLV
SGRHWLHAANLYSIAAYPHIKGDELAEQAQVLAYRAYEEAAQRLPGKLRELEFAIPGAAP
ITGFLHMPPGDGPFPTVLMCGGLDALQTDYYNLYENYFAPLGIAMLTVDMPSIGFSSKCK
LTQDTSMLHQYVLQHLSNVPWVDHTRVAAFGFRFGANIAVRLGYLEPQRLKAVACLGPVV
HGLLVDPLHQGRVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLLGRRCPTPMLS
GFWKDDPFSPEEESRLITSSSSDGKLLEIPFNPVYRNFDHALRQIARWISHRFS