Protein Info for BWI76_RS05435 in Klebsiella michiganensis M5al

Annotation: murein transglycosylase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01464: SLT" amino acids 105 to 217 (113 residues), 107.6 bits, see alignment E=5.8e-35 PF01476: LysM" amino acids 346 to 387 (42 residues), 52.9 bits, see alignment 5.9e-18 amino acids 405 to 444 (40 residues), 40.8 bits, see alignment 3.5e-14

Best Hits

Swiss-Prot: 86% identical to MLTD_ECOL6: Membrane-bound lytic murein transglycosylase D (mltD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_11830)

MetaCyc: 86% identical to membrane-bound lytic murein transglycosylase D (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ08 at UniProt or InterPro

Protein Sequence (455 amino acids)

>BWI76_RS05435 murein transglycosylase D (Klebsiella michiganensis M5al)
MKARAILLASVLLVGCQASKNDGTVQQHAQSLSAASQGEASKFTSRARWLDDGTFYAQDQ
DLWTSIGDELKMGIPENVRIREQKQKYLRNKSYLHDVTLRAEPYMYWIAGQVKKRNMPME
LVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRSYDARRDIVASTTAALNMM
QRLNKMFDGDWLLTVAAYNSGEGRVMKAIKANKSRGKPTDFWSLSLPQETKIYVPKMLAL
SDILKNSKRYGIRLPTADESRALARVRLDSPVEISQLADMAGMPVSKLKTFNAGVKGSTL
GANGPNYVLVPQKHAAQLRESLASGDIAAVQPTQLADNRPLTSRSYQVRSGDTLSGIASR
LGVSAKDLQQWNGIRGSGLKVGQNLVIGAGSSAERLANNSDSITYRVRKGDSLSSIAKRH
GVNIRDVMRWNSDTGNLKPGDQLTLYVKNSDRPES