Protein Info for BWI76_RS05430 in Klebsiella michiganensis M5al

Annotation: UbiE/COQ5 family methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13489: Methyltransf_23" amino acids 31 to 192 (162 residues), 72.2 bits, see alignment E=2.5e-23 PF01209: Ubie_methyltran" amino acids 36 to 153 (118 residues), 67 bits, see alignment E=9.9e-22 PF05175: MTS" amino acids 36 to 146 (111 residues), 28.5 bits, see alignment E=6.7e-10 PF00891: Methyltransf_2" amino acids 37 to 188 (152 residues), 22.6 bits, see alignment E=3.6e-08 PF07021: MetW" amino acids 44 to 138 (95 residues), 21.4 bits, see alignment E=1.1e-07 PF03141: Methyltransf_29" amino acids 45 to 145 (101 residues), 30.5 bits, see alignment E=9.2e-11 PF13847: Methyltransf_31" amino acids 45 to 156 (112 residues), 87.6 bits, see alignment E=4.6e-28 PF05148: Methyltransf_8" amino acids 45 to 154 (110 residues), 31.9 bits, see alignment E=7.9e-11 PF03848: TehB" amino acids 46 to 150 (105 residues), 22.3 bits, see alignment E=4.7e-08 PF13649: Methyltransf_25" amino acids 48 to 141 (94 residues), 87.8 bits, see alignment E=3.8e-28 PF08242: Methyltransf_12" amino acids 49 to 142 (94 residues), 62.2 bits, see alignment E=3.9e-20 PF08241: Methyltransf_11" amino acids 49 to 145 (97 residues), 97.6 bits, see alignment E=3.2e-31

Best Hits

KEGG orthology group: None (inferred from 93% identity to eae:EAE_11825)

Predicted SEED Role

"SAM-dependent methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ27 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BWI76_RS05430 UbiE/COQ5 family methyltransferase (Klebsiella michiganensis M5al)
MTTRSHHDNVEKQFGSQASAYLTSAVHASGRDLQRLAERLADFPQAHVLDMGCGAGHASF
AAAGQVAQVTAYDLSSQMLDVVAQAARDKGFTNIATQQGYAESLPFADASFDVAISRYSA
HHWHDVGQALREVKRVLKPGGVMIIMDVMSPGHPVRDVWLQTVEALRDTSHVRNYSSGEW
LAMASEAGLVINHLLTDRLPLEFSSWVARMRTPAALTEAIRLYQDSASAEVKAYFALQQD
GSFTSDTIMFEAHKAI