Protein Info for BWI76_RS05420 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 320 (313 residues), 149.5 bits, see alignment E=1.8e-47 amino acids 225 to 389 (165 residues), 57.8 bits, see alignment E=1.4e-19 PF06779: MFS_4" amino acids 13 to 376 (364 residues), 47.8 bits, see alignment E=2.2e-16 PF00083: Sugar_tr" amino acids 39 to 173 (135 residues), 27.1 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 52% identical to YTBD_BACSU: Uncharacterized MFS-type transporter YtbD (ytbD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to kpu:KP1_1067)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYX2 at UniProt or InterPro

Protein Sequence (396 amino acids)

>BWI76_RS05420 MFS transporter (Klebsiella michiganensis M5al)
MPLALLALTIGAFAIGTTEFVIVGLVPTIAEQLAISLPSAGLLVSIYALGVAIGAPVLTA
LTGRMPRKQLLLALMALFTAGNLLAWQAPGYETLVLARLLTGLAHGVFFSIGSTIATSLV
PKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAVSILGVIALMSSLILVPN
NIPGRVSAGLRAQLQVLTHPRLLIIYAITALGYGGVFTAFTFLAPMMQDLAGFSPAAVSW
ILLGYGVSVAVGNVWGGRLADKHGAVPALKLIFAALVALLLIFQFTASLQYAALATVLVM
GIFAFGNVPGLQVYVVQKAEQYTPGAVDVASGLNIAAFNIGIALGSVIGGQTVEHYGLAQ
TPWIGALIVLVALLLVVLSGRLDRPRRRTTALSVEG