Protein Info for BWI76_RS05370 in Klebsiella michiganensis M5al

Annotation: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR00213: D,D-heptose 1,7-bisphosphate phosphatase" amino acids 6 to 180 (175 residues), 330.1 bits, see alignment E=4.2e-103 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 6 to 151 (146 residues), 135.8 bits, see alignment E=1.7e-43 TIGR01662: HAD hydrolase, family IIIA" amino acids 7 to 155 (149 residues), 129 bits, see alignment E=2.1e-41 PF08645: PNK3P" amino acids 11 to 139 (129 residues), 32.9 bits, see alignment E=1.1e-11 PF00702: Hydrolase" amino acids 23 to 148 (126 residues), 36.8 bits, see alignment E=1.1e-12 PF13419: HAD_2" amino acids 106 to 150 (45 residues), 26.3 bits, see alignment E=1.5e-09 PF13242: Hydrolase_like" amino acids 109 to 179 (71 residues), 48 bits, see alignment E=1.9e-16

Best Hits

Swiss-Prot: 93% identical to GMHBB_SHIFL: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Shigella flexneri

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 93% identity to eco:b0200)

MetaCyc: 93% identical to D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-4361 [EC: 3.1.3.82]

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYW0 at UniProt or InterPro

Protein Sequence (188 amino acids)

>BWI76_RS05370 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase (Klebsiella michiganensis M5al)
MAMSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRQLKEMGYALVVVTNQSGIAR
GKFTEEQFETLTEWMDWSLADRGVDLDGIYYCPHHPQGTVEEFRQTCDCRKPHPGMLISA
RDYLHIDMAASYMVGDKVEDMQAALAANVGTKVLVRTGKPVTPEAESAADWVLNSLADLP
DAIKKQQK