Protein Info for BWI76_RS05360 in Klebsiella michiganensis M5al

Annotation: methionine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 32 to 214 (183 residues), 75.1 bits, see alignment E=3.2e-25

Best Hits

Swiss-Prot: 97% identical to METI_ECOLI: D-methionine transport system permease protein MetI (metI) from Escherichia coli (strain K12)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 97% identity to eco:b0198)

MetaCyc: 97% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYV2 at UniProt or InterPro

Protein Sequence (217 amino acids)

>BWI76_RS05360 methionine ABC transporter permease (Klebsiella michiganensis M5al)
MSEPMIWLLVRGVWETLAMTFVSGFFGFVLGLPVGVLLYVTRPGQIAANAKLYRTLSAVV
NIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLI
EASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYG
YIGYNATVMNTVLVLLVILVYLIQFSGDRIVRAVTHK