Protein Info for BWI76_RS05260 in Klebsiella michiganensis M5al

Annotation: chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03938: OmpH" amino acids 23 to 159 (137 residues), 89.7 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 90% identical to SKP_SHISS: Chaperone protein Skp (skp) from Shigella sonnei (strain Ss046)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_11685)

MetaCyc: 90% identical to periplasmic chaperone Skp (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Outer membrane chaperone Skp (OmpH) precursor @ Outer membrane protein H precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYT2 at UniProt or InterPro

Protein Sequence (161 amino acids)

>BWI76_RS05260 chaperone (Klebsiella michiganensis M5al)
MKKWLLAAGLGLAMVTSAQAADKIAMVNMNSLFQQVAQKTGVSNTLENEFKGRASELQRM
EGDLQSKMQRLQSMKAGSDRTKLEKDVMAQRQTFSQKAQSFEQDRARRSNEERGKLVTRI
QSAVQSVAKDQSIDLVVDSNAVAYNSSDVKDITADVLKQVK