Protein Info for BWI76_RS05240 in Klebsiella michiganensis M5al

Annotation: (2E,6E)-farnesyl- diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 18 to 243 (226 residues), 342.2 bits, see alignment E=6.1e-107 PF01255: Prenyltransf" amino acids 23 to 243 (221 residues), 281 bits, see alignment E=3.3e-88

Best Hits

Swiss-Prot: 89% identical to UPPS_SALTY: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (uppS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 95% identity to kva:Kvar_4194)

MetaCyc: 89% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYU7 at UniProt or InterPro

Protein Sequence (252 amino acids)

>BWI76_RS05240 (2E,6E)-farnesyl- diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase (Klebsiella michiganensis M5al)
MLSANQTVSEMLPAHGCRHVAIIMDGNGRWAKRQGKIRAFGHKAGAKSVRRAVSFAANNG
IEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGETTRFNARLQ
ERIRKAEALTENNTGLTLNIAANYGGRWDIVQGVRHLAKQVQDGLLQPEQITEEMLSQQV
CMHELAPVDLVIRTGGEHRISNFLIWQIAYAELYFTDVLWPDFAEQDFEGALHAFVNRER
RFGGTEPGGNNA