Protein Info for BWI76_RS05215 in Klebsiella michiganensis M5al

Annotation: elongation factor Ts

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00116: translation elongation factor Ts" amino acids 1 to 282 (282 residues), 400.3 bits, see alignment E=2.2e-124 PF00889: EF_TS" amino acids 79 to 263 (185 residues), 216.2 bits, see alignment E=1.8e-68

Best Hits

Swiss-Prot: 97% identical to EFTS_ENT38: Elongation factor Ts (tsf) from Enterobacter sp. (strain 638)

KEGG orthology group: K02357, elongation factor Ts (inferred from 97% identity to ent:Ent638_0708)

Predicted SEED Role

"Translation elongation factor Ts"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYT3 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS05215 elongation factor Ts (Klebsiella michiganensis M5al)
MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADG
VIITKIDGTYGIILEVNCQTDFVAKDGGFQAFANKVLDAAVAGKITDVEVLKAQFEEERV
ALVAKIGENINIRRVSSLEGEVLGSYQHGARIGVLVAAKGASEELVKQLAMHIAASKPEF
VKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMDPSK
SVAQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS