Protein Info for BWI76_RS05180 in Klebsiella michiganensis M5al

Annotation: serine endoprotease DegQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 41 to 477 (437 residues), 552.6 bits, see alignment E=3.4e-170 PF00089: Trypsin" amino acids 110 to 280 (171 residues), 86.4 bits, see alignment E=6.5e-28 PF13365: Trypsin_2" amino acids 119 to 255 (137 residues), 119.5 bits, see alignment E=5.2e-38 PF00595: PDZ" amino acids 290 to 372 (83 residues), 56.2 bits, see alignment E=9.3e-19 amino acids 398 to 468 (71 residues), 47.1 bits, see alignment E=6.2e-16 PF13180: PDZ_2" amino acids 310 to 385 (76 residues), 57.4 bits, see alignment E=3.8e-19 amino acids 410 to 455 (46 residues), 33.7 bits, see alignment 9.5e-12 PF17820: PDZ_6" amino acids 320 to 356 (37 residues), 39.7 bits, see alignment 8.6e-14 amino acids 417 to 469 (53 residues), 39.4 bits, see alignment 1.1e-13

Best Hits

Swiss-Prot: 91% identical to DEGP_SALTY: Periplasmic serine endoprotease DegP (degP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04771, serine protease Do [EC: 3.4.21.107] (inferred from 97% identity to kpe:KPK_4557)

MetaCyc: 89% identical to periplasmic serine endoprotease DegP (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AZ11 at UniProt or InterPro

Protein Sequence (479 amino acids)

>BWI76_RS05180 serine endoprotease DegQ (Klebsiella michiganensis M5al)
MKKTTLAMSALALSLGLALSPLSASAAETASSATNAQQMPSLAPMLEKVMPSVVSINVEG
STTVNTPRMPRNFQQFFGDNSPFCQDGSPFQSSPFCQGGGQGGAPGSDGGQQQKFMALGS
GVIIDAAKGYVVTNNHVVDNATTIKVQLSDGRKFDAKVVGKDPRSDIALIQIQDPKNLSA
IKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGN
SGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTDQMVKFGQVKRGELGIMG
TELNSELAKAMKVDAQRGAFVSQVMPNSAAAKAGIKAGDVITTLNGKSISSFAALRAQVG
TMSIGSKVELGLLRDGKPVTVTVELQQSNQNQVDSSTIFNGIEGAEMSNKGQDKGVVVSN
VKAGTPAAQIGLKKGDIIVGANQQPVKNIADLRKIFDAKPSVLALNIQRGDTSIYLLMQ