Protein Info for BWI76_RS05150 in Klebsiella michiganensis M5al

Annotation: ClC family H(+)/Cl(-) exchange transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 335 to 362 (28 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 402 to 427 (26 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 105 to 450 (346 residues), 330.1 bits, see alignment E=8.6e-103

Best Hits

Swiss-Prot: 92% identical to CLCA_KLEP7: H(+)/Cl(-) exchange transporter ClcA (clcA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_11575)

MetaCyc: 75% identical to chloride:H+ antiporter ClcA (Escherichia coli K-12 substr. MG1655)
RXN0-2501

Predicted SEED Role

"H(+)/Cl(-) exchange transporter ClcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYW6 at UniProt or InterPro

Protein Sequence (486 amino acids)

>BWI76_RS05150 ClC family H(+)/Cl(-) exchange transporter (Klebsiella michiganensis M5al)
MPFFLFVLLIIDNGMKAENPSSSAHQFVRVRRSDAVRRLIQRDKTPLAVLLMAAVVGTLA
GLVGVAFEKSVNWVQNLRIGALVEVADHWFLVWPLAFILSALLAMVGYFLVRRFAPEAGG
SGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPMVQLGGNLGRMVVDVF
RMRSPEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGVIMAT
IVFRIFNGDKAVIEVGKLSNAPVNTLWLYLILGMIFGCIGPLFNTLVLRTQDMFQRIHGG
NIKKWVLIGGLIGGSCGVLGLIQPTASGGGFNLIPIAAAGNFSVGLLLFIFIARVITTLL
CFSSGAPGGIFAPMLALGTLLGTAFGMAATPLFPAYHLDAGTFAIAGMGALLAASVRAPL
TGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILQRTLAKQKAEQEARAQP
VGGENT