Protein Info for BWI76_RS05145 in Klebsiella michiganensis M5al

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00713: glutamate-1-semialdehyde-2,1-aminomutase" amino acids 3 to 425 (423 residues), 675.8 bits, see alignment E=1e-207 PF00202: Aminotran_3" amino acids 32 to 395 (364 residues), 267.5 bits, see alignment E=9e-84

Best Hits

Swiss-Prot: 97% identical to GSA_KLEP7: Glutamate-1-semialdehyde 2,1-aminomutase (hemL) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K01845, glutamate-1-semialdehyde 2,1-aminomutase [EC: 5.4.3.8] (inferred from 97% identity to kpu:KP1_1006)

MetaCyc: 93% identical to glutamate-1-semialdehyde 2,1-aminomutase (Escherichia coli K-12 substr. MG1655)
Glutamate-1-semialdehyde 2,1-aminomutase. [EC: 5.4.3.8]

Predicted SEED Role

"Glutamate-1-semialdehyde aminotransferase (EC 5.4.3.8)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 5.4.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYX0 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BWI76_RS05145 aspartate aminotransferase family protein (Klebsiella michiganensis M5al)
MSKSENLYNAARELIPGGVNSPVRAFTGVGGTPLFIERADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAALVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLSSVRAAFEQYPQDIACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRREVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLSEVAQPGVHETLTELTNQLAQGLLDAARDAGIPLVVNNVGGMFGIFFT
DAPTVTCYQDVVKCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSIAHSEEDIDNTVAAAR
NAFAKL