Protein Info for BWI76_RS05125 in Klebsiella michiganensis M5al

Annotation: ferrichrome porin FhuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07715: Plug" amino acids 76 to 181 (106 residues), 91.8 bits, see alignment E=3.8e-30 TIGR01783: TonB-dependent siderophore receptor" amino acids 78 to 734 (657 residues), 507.1 bits, see alignment E=4.4e-156 PF00593: TonB_dep_Rec" amino acids 254 to 703 (450 residues), 205.1 bits, see alignment E=3.7e-64

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 89% identity to kpu:KP1_1002)

Predicted SEED Role

"Ferric hydroxamate outer membrane receptor FhuA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYV3 at UniProt or InterPro

Protein Sequence (734 amino acids)

>BWI76_RS05125 ferrichrome porin FhuA (Klebsiella michiganensis M5al)
MARLKTAQPNHSLRKIAAVVATAVSGMSVYAQAAVEPKEETITVTAAPAPQESAWGPAAT
IAAKHSATATKTDTPIEKTPQSISVVTRQEMEMKQPTTVKEALAYTPGVFSTRGSSTTYD
VVTIRGFTTSTTVNTNQYLDGMKLQGNNYSEVSMDPYFLERVEVMRGPTSVLYGNSNPGG
IVSMVSKRPTTEPLKEIQFKMGTDNLWQTGFDFSDAIDDDGVWSYRLTGLGRSQDAQQQM
AKSTRYAVAPSFSWRPDDKTDFTFLSNFQSDPYAGYYGWLPREGTVVPYYDANGKAHKLP
TDFNEGEANNKMSRRQQMVGYSFSHQFDDTFTVRQNLRYADVHTLYRSVYGNGYTPTGKI
NRAYVRSDEHLNTFTVDTQLQSDFATGAVGHTLLTGVDYSRMRNDVKADYGTASAIDMQN
PQYGNPDVSVNFPYSVLNRMEQTGLYAQDQMAWDKWVMTLGGRYDYAMASTLTRPANTLA
KNHDQQFTWRGGINYLFDNGISPYFSYSQSFEPVSGSSRDGKPFDASHGEQYEAGVKYVP
KDMPVVLTAAVYQLTKDKNLTADPNNSSFSIQTGEIRSRGIELEAKAAVNANVNVTASYT
YTDAQYQHDTTFNGKRPAEVPRNMASLWADYTFHETALSGLTVGAGARYVGSTVSYYKNN
TSTGKKDESFNVAGYALMDATVKYDLARFGLPGSSIGVNVNNLFDREYVSSCYSEYACYW
GAERQVVATATFRF