Protein Info for BWI76_RS05110 in Klebsiella michiganensis M5al

Annotation: pullulanase secretion protein PulS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01004: lipoprotein, PulS/OutS family" amino acids 1 to 125 (125 residues), 208.6 bits, see alignment E=1.1e-66 PF09691: T2SS_PulS_OutS" amino acids 15 to 119 (105 residues), 104.1 bits, see alignment E=2.3e-34

Best Hits

Swiss-Prot: 100% identical to PULS_KLEPN: Pullulanase secretion protein PulS (pulS) from Klebsiella pneumoniae

KEGG orthology group: K02465, general secretion pathway protein S (inferred from 74% identity to kpu:KP1_0998)

Predicted SEED Role

"Pullulanase secretion protein pulS precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>BWI76_RS05110 pullulanase secretion protein PulS (Klebsiella michiganensis M5al)
MRNFILFPMMAVVLLSGCQQNRPTTLSPAVSGQAQLEQLASVAAGARYLKNKCNRSDLPA
DEAINRAAINVGKKRGWANIDANLLSQRSAQLYQQLQQDSTPEATKCSQFNRQLAPFIDS
LRDNK