Protein Info for BWI76_RS05105 in Klebsiella michiganensis M5al

Annotation: general secretion pathway protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details PF16537: T2SSB" amino acids 99 to 158 (60 residues), 68.5 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 99% identical to GSPB_KLEPN: General secretion pathway protein B (pulB) from Klebsiella pneumoniae

KEGG orthology group: K02451, general secretion pathway protein B (inferred from 63% identity to kpe:KPK_4572)

Predicted SEED Role

"General secretion pathway protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYW2 at UniProt or InterPro

Protein Sequence (174 amino acids)

>BWI76_RS05105 general secretion pathway protein B (Klebsiella michiganensis M5al)
MLVRPQEPYPQSEPPAAVGRMVQIPYVTVPLYAALLIALGWFGGEQWRNKPEPQPMRQSV
AHAALVPLNQPAVKAAVAPVNAGPEIQAEPEIAIDEDNLPPLRYSAHVYASLADKRSIVL
NGQSWKEGDSPLANLVIEQIQQDLTVFSFNGKTFTLAALDDWPGGAIEESPQAE