Protein Info for BWI76_RS05095 in Klebsiella michiganensis M5al

Annotation: pullulanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details TIGR01713: type II secretion system protein C" amino acids 21 to 275 (255 residues), 355.2 bits, see alignment E=1.2e-110 PF11356: T2SSC" amino acids 28 to 161 (134 residues), 66.1 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 100% identical to GSPC_KLEPN: Type II secretion system protein C (pulC) from Klebsiella pneumoniae

KEGG orthology group: K02452, general secretion pathway protein C (inferred from 58% identity to kpu:KP1_0991)

Predicted SEED Role

"General secretion pathway protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYR4 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BWI76_RS05095 pullulanase (Klebsiella michiganensis M5al)
MHNSVMRLTIPNKKIINYAPHIVTSIILFFICQQLAQLTWKIILPVNFTDNALSSADMTS
PAAPSAETALPRFTLFGLAEKTSASAPGGNLDQAPVSALRLRVTGLLASTDPSRAIAIMM
KGNQQVSLGIGDNTPGGEAKIIAISPDRLIVNYRGRNEAIPLFNDPPAVGKNSAAPPARH
LAQELRAQPQNILHYLNISPVMVNDKLSGYRLNPGKDPALFRQSGLRENDLAIALNGLDL
RDKEQARQVLAQLPELTEITLTVERDGQKNDIYLALRDE