Protein Info for BWI76_RS05090 in Klebsiella michiganensis M5al

Annotation: type II secretion system protein GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 33 to 102 (70 residues), 91.1 bits, see alignment E=4.8e-30 TIGR02517: type II secretion system protein D" amino acids 33 to 602 (570 residues), 552.3 bits, see alignment E=6.8e-170 PF03958: Secretin_N" amino acids 129 to 191 (63 residues), 51.5 bits, see alignment E=1.4e-17 amino acids 195 to 264 (70 residues), 60.6 bits, see alignment E=2.1e-20 amino acids 269 to 346 (78 residues), 63.6 bits, see alignment E=2.4e-21 PF00263: Secretin" amino acids 430 to 595 (166 residues), 168.8 bits, see alignment E=1.2e-53

Best Hits

Swiss-Prot: 100% identical to GSPD_KLEPN: Secretin PulD (pulD) from Klebsiella pneumoniae

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 93% identity to kpu:KP1_0990)

MetaCyc: 57% identical to type II secretion system protein GspD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AYR1 at UniProt or InterPro

Protein Sequence (660 amino acids)

>BWI76_RS05090 type II secretion system protein GspD (Klebsiella michiganensis M5al)
MIIANVIRSFSLTLLIFAALLFRPAAAEEFSASFKGTDIQEFINTVSKNLNKTVIIDPSV
RGTITVRSYDMLNEEQYYQFFLSVLDVYGFAVINMNNGVLKVVRSKDAKTAAVPVASDAA
PGIGDEVVTRVVPLTNVAARDLAPLLRQLNDNAGVGSVVHYEPSNVLLMTGRAAVIKRLL
TIVERVDNAGDRSVVTVPLSWASAADVVKLVTELNKDTSKSALPGSMVANVVADERTNAV
LVSGEPNSRQRIIAMIKQLDRQQATQGNTKVIYLKYAKASDLVEVLTGISSTMQSEKQAA
KPVAALDKNIIIKAHGQTNALIVTAAPDVMNDLERVIAQLDIRRPQVLVEAIIAEVQDAD
GLNLGIQWANKNAGMTQFTNSGLPISTAIAGANQYNKDGTVSSSLASALSSFNGIAAGFY
QGNWAMLLTALSSSTKNDILATPSIVTLDNMEATFNVGQEVPVLTGSQTTSGDNIFNTVE
RKTVGIKLKVKPQINEGDSVLLEIEQEVSSVADAASSTSSDLGATFNTRTVNNAVLVGSG
ETVVVGGLLDKSVSDTADKVPLLGDIPVIGALFRSTSKKVSKRNLMLFIRPTVIRDRDEY
RQASSGQYTAFNDAQSKQRGKENNDAMLNQDLLEIYPRQDTAAFRQVSAAIDAFNLGGNL